DPCfam | MC104198
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Residues in low-complexity regions (%) | 0.87 |
| Residues in coiled-coil regions (%) | 0.56 |
| Predicted disordered residues (%) | 13.89 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF04499 |
| Sequences matching dominant architecture (%) | 98.56 |
| Average overlap percent | 14.43 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G4N8M9 | 337-402 | 66 | IYLGTLLRMFAEGVPKFMNLIMIGEEKPHFESTFGERIQPLGFDRFKTCELMAELLHCSNMGLLNE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O74511-F1 | 316-385 | 98.59 | 92.31 | View in AlphaFoldDB ↗ |