DPCfam | MC103618
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 501 ± 55 aa |
| Residues in low-complexity regions (%) | 8.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.53 |
| Average transmembrane regions | 5.86 |
| Dominant Pfam architecture(s) | PF10110- PF03009 |
| Sequences matching dominant architecture (%) | 79.27 |
| Average overlap percent | 89.78 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G9WI19 | 124-545 | 422 | NIGYKLPLATLIKLPDFIIQPFAGNIFLIAAILLGLICFWLFTIKFLQVIPAVMSGQSFFQALRYSWKEMPTKKILHLCLILFIN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132ZG82-F1 | 64-575 | 99.80 | 89.00 | View in AlphaFoldDB ↗ |