DPCfam | MC103607
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Residues in low-complexity regions (%) | 3.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00903- PF00903 |
| Sequences matching dominant architecture (%) | 57.14 |
| Average overlap percent | 28.38 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D7A6S1 | 124-197 | 74 | LDDPDGNGIEIYRDRRPDEWNWDGATIEMATYRLDLRALIADAPAGVPLGAPMPEGTKVGHVHLQVGDLTAARR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P54721-F1 | 121-184 | 98.46 | 97.42 | View in AlphaFoldDB ↗ |