DPCfam | MC103580
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 7751 |
|---|---|
| Mean domain length (aa) | 90 ± 15 aa |
| Residues in low-complexity regions (%) | 0.99 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 20.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00439 |
| Sequences matching dominant architecture (%) | 95.98 |
| Average overlap percent | 81.87 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A3LRA0 | 45-125 | 81 | DYYKIVKNPLSLHGVGRKIKNSKYDDGQQFVDDLSQVSWNARLYNIRESKVYRHALILKQFVLTVVIPKLKNDKAVPNSKT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7FHF0-F1 | 55-134 | 81.25 | 89.86 | View in AlphaFoldDB ↗ |