DPCfam | MC103480
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 57 ± 7 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01426 |
| Sequences matching dominant architecture (%) | 97.37 |
| Average overlap percent | 15.64 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E9FRL5 | 680-739 | 60 | GRPIDAVEEHVYICEYRVDRTASLFSKNARTKFPICTRRFAFKSFVTRLKPQRTYQPHGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VW15-F1 | 2050-2101 | 94.64 | 81.17 | View in AlphaFoldDB ↗ |