DPCfam | MC103458
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 201 ± 47 aa |
| Residues in low-complexity regions (%) | 1.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18922 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 80.19 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M4R5Q7 | 44-238 | 195 | QKQLPAKRLRCLLISPEKPEHFFDNIQHIACKPFSYLEYSLFMVYSLAQFIETSHVLIVQEDGWVLNGNNWRDEFFQYDYIGSPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PPH6-F1 | 130-279 | 80.60 | 97.44 | View in AlphaFoldDB ↗ |