DPCfam | MC103368
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 127 ± 21 aa |
| Residues in low-complexity regions (%) | 2.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.35 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01630 |
| Sequences matching dominant architecture (%) | 96.34 |
| Average overlap percent | 45.52 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q08169 | 246-362 | 117 | WLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QNM5-F1 | 236-376 | 100.00 | 97.16 | View in AlphaFoldDB ↗ |