DPCfam | MC103255
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 603 ± 69 aa |
| Residues in low-complexity regions (%) | 8.66 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 12.43 |
| Average transmembrane regions | 6.23 |
| Dominant Pfam architecture(s) | PF13676 |
| Sequences matching dominant architecture (%) | 40.98 |
| Average overlap percent | 13.81 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R1B798 | 1051-1703 | 653 | AKTKVLFGFYQICTVLSSTYSARLPPEYTGWTDKLANTVSIDWTGYFLPQQCLGYDLRLLAIALSPVALIALLMGTGIALRLRRW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IBR8-F1 | 1834-2111 | 36.60 | 79.54 | View in AlphaFoldDB ↗ |