DPCfam | MC103165
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 441 |
|---|---|
| Mean domain length (aa) | 73 ± 11 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04748 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 34.23 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E7HMF6 | 84-147 | 64 | LPMEPQEYPKIDPGKGSLLTSMDADTLIRQLKEDIAQLPCIVGVNNHMGSGLTQDSERMKLIFT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q329P0-F1 | 24-98 | 97.47 | 97.90 | View in AlphaFoldDB ↗ |