DPCfam | MC103154
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 152 ± 8 aa |
| Residues in low-complexity regions (%) | 1.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.86 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00557 |
| Sequences matching dominant architecture (%) | 20.0 |
| Average overlap percent | 36.89 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A177ZS39 | 296-449 | 154 | PYFKAIATWYQEVGIGVRGGDLFEKCRTVLAEGNLKPALNPGHLTSTDEWLHTPIRPNSGEVIASGMAFQCDIIPTPLPHGVGLN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZFA1-F1 | 268-384 | 76.62 | 93.28 | View in AlphaFoldDB ↗ |