DPCfam | MC103084
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 142 ± 17 aa |
| Residues in low-complexity regions (%) | 5.85 |
| Residues in coiled-coil regions (%) | 0.27 |
| Predicted disordered residues (%) | 4.46 |
| Average transmembrane regions | 2.27 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F8W354 | 27-180 | 154 | RSLTGFALGLFLASVYGVTALYIQHHDVWFCVISTAILAVFVGFGTGLSERVRTNVMLMFPVLCSMRGKNLLLFFICTLVIHGPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F8W407-F1 | 36-178 | 96.62 | 86.14 | View in AlphaFoldDB ↗ |