DPCfam | MC102739
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 206 ± 19 aa |
| Residues in low-complexity regions (%) | 3.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13229 |
| Sequences matching dominant architecture (%) | 4.55 |
| Average overlap percent | 61.54 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0W1R3M5 | 248-439 | 192 | IQVLGGEYANNGLSQVRVGGGNADTPALVKDVTVRIDKPRPDMKNMRGIWLKEGDGTVIEDCTIKITSLEGTLSSGGIVVDKEHG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q552D1-F1 | 342-416 | 37.38 | 87.89 | View in AlphaFoldDB ↗ |