DPCfam | MC102485
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Residues in low-complexity regions (%) | 7.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06224 |
| Sequences matching dominant architecture (%) | 97.93 |
| Average overlap percent | 20.93 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W7S725 | 4-103 | 100 | LTRRALNRALLHRQLLLRRWKLTPAKAIERVVALQAQATNPPYFALWTRLDGFRREQLSRLLTDRRVARLALMRGTLHLATADDC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0FB43-F1 | 4-93 | 97.83 | 98.04 | View in AlphaFoldDB ↗ |