DPCfam | MC102435
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Residues in low-complexity regions (%) | 6.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.97 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF00168 |
| Sequences matching dominant architecture (%) | 45.0 |
| Average overlap percent | 7.6 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M3Z076 | 748-864 | 117 | EYESQIEKDISISDVNSIIAQRINSANFLKKMRRLIMKRIVKVSKFNLSDVVADYEEIVSASQLTHAVCKLVERRRQLKPQRKER... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QEZ0-F1 | 1000-1113 | 98.28 | 67.95 | View in AlphaFoldDB ↗ |