DPCfam | MC10218
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 239 ± 22 aa |
| Residues in low-complexity regions (%) | 2.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05345 |
| Sequences matching dominant architecture (%) | 12.2 |
| Average overlap percent | 0.94 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000711793E | 24-258 | 235 | TCEDNEVYIRVAKNCGARADEESYVIKSGNSVVVTSLPFADNEFRETEYCLPQSTDSQYTFLVKDSYGDGWSKSSYFIVYSQYDS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q82PP4-F1 | 253-370 | 45.16 | 96.35 | View in AlphaFoldDB ↗ |