DPCfam | MC101420
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 68 ± 3 aa |
| Residues in low-complexity regions (%) | 1.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08685 |
| Sequences matching dominant architecture (%) | 98.68 |
| Average overlap percent | 35.16 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V0Y600 | 339-407 | 69 | NCPQGRFSIDLRGTGFRVSPKTTWMHEGHRAFSEVKRNTNSVLVIGSCGGYCGKCAPHKRVGLLIETLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A158Q684-F1 | 57-122 | 97.06 | 96.39 | View in AlphaFoldDB ↗ |