DPCfam | MC101254
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 154 ± 21 aa |
| Residues in low-complexity regions (%) | 2.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01590 |
| Sequences matching dominant architecture (%) | 5.75 |
| Average overlap percent | 54.87 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1H6ESY7 | 12-165 | 154 | LGRAVPAEGTCLMTTDPATMLPTAEFVENGLPAAELLRLVEIEVREPDFNTWVQLSHAGRPAGSLSEATAGDLDRSLRQREIRRP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F1K7-F1 | 17-170 | 95.03 | 90.29 | View in AlphaFoldDB ↗ |