DPCfam | MC10107
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 400 ± 71 aa |
| Residues in low-complexity regions (%) | 6.1 |
| Residues in coiled-coil regions (%) | 8.58 |
| Predicted disordered residues (%) | 34.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05508 |
| Sequences matching dominant architecture (%) | 96.97 |
| Average overlap percent | 80.76 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q0U5B7 | 95-507 | 413 | EELATLQLRLDSKIKIVSPAIDMIELIAARGNTSLESAVTLTKSLRWDIQTLGSRVEKAVIEEQLSRRGSSKARSRAQNDIELNV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NRY5-F1 | 1-435 | 98.66 | 71.14 | View in AlphaFoldDB ↗ |