DPCfam | MC100981
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Residues in low-complexity regions (%) | 0.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.73 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000759A96F | 122-199 | 78 | EEFVGQRVELDGRAYTRCAFRGCVLVYSGGSYGSLEHCTFEACQWSFDGAAATTMAFLGLMYHRMGDEGRKIVEDTLT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P05530-F1 | 29-68 | 50.63 | 95.81 | View in AlphaFoldDB ↗ |