DPCfam | MC10094
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 476 ± 24 aa |
| Residues in low-complexity regions (%) | 1.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14401- PF08443 |
| Sequences matching dominant architecture (%) | 66.67 |
| Average overlap percent | 90.08 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A136HFX4 | 5-499 | 495 | VIVIDSQADWECHLNPEQVITFEQFLAHQYPIALVAKSGKKSSLRVINLCKSHAYLSLGYYCSLIAEARGHNVIPSISTLNDLSQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I2G0-F1 | 6-489 | 99.79 | 85.77 | View in AlphaFoldDB ↗ |