DPCfam | MC100828
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 59.97 |
| Predicted disordered residues (%) | 17.04 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF04484 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 19.76 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K9PEC4 | 330-408 | 79 | DTQSLNDSINSAIDAMRFLGSSICSLLSKVKNTNSILSELSNLALEETFLLDECRDLLASTASMQVKESSLRTQLLQLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0PAQ8-F1 | 462-540 | 98.75 | 92.01 | View in AlphaFoldDB ↗ |