DPCfam | MC100707
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 87 ± 16 aa |
| Residues in low-complexity regions (%) | 11.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 55.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T2M375 | 45-133 | 89 | KVVLKSTTTQTLSDRFTEMLRKKAPSPIRKDTNQFRASAKNRRLAEQMSRRTGLHAVMDQVQQSTDIKSRLDKSKIRSNVKDRLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-M0RDD7-F1 | 7-91 | 94.74 | 76.32 | View in AlphaFoldDB ↗ |