DPCfam | MC100679
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 283 ± 36 aa |
| Residues in low-complexity regions (%) | 15.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 58.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01369 |
| Sequences matching dominant architecture (%) | 3.57 |
| Average overlap percent | 40.99 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00097D3023 | 2-272 | 271 | LENSTAPPSGNSSESPTPTPPSSLPLLSANHEVQHVEVELVTPPPAIIGTSPKTGIIRRTLKYSETDLDAVPLRCYRETDIDEVM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1MUS9-F1 | 258-448 | 66.23 | 36.30 | View in AlphaFoldDB ↗ |