DPCfam | MC100411
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Residues in low-complexity regions (%) | 6.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.32 |
| Average transmembrane regions | 2.52 |
| Dominant Pfam architecture(s) | PF02447 |
| Sequences matching dominant architecture (%) | 68.18 |
| Average overlap percent | 29.67 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K1XG72 | 107-199 | 93 | AGAILTYGGVSVFVVGFTLYPIAFELFRSANIAHRFIPAAIIFGSISFTMVSPGSPEIQNLIPTTYFGTTATAGGIIGVLMGLLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I2A5-F1 | 102-190 | 98.89 | 93.85 | View in AlphaFoldDB ↗ |