DPCfam | MC100301
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 513 ± 80 aa |
| Residues in low-complexity regions (%) | 2.32 |
| Residues in coiled-coil regions (%) | 4.45 |
| Predicted disordered residues (%) | 3.11 |
| Average transmembrane regions | 7.61 |
| Dominant Pfam architecture(s) | PF02949- PF02949 |
| Sequences matching dominant architecture (%) | 86.21 |
| Average overlap percent | 78.7 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L7R6L3 | 89-595 | 507 | SIEILRRRLEEEPCKPVSAEEAVIQNFCGRVERAARSVTIYYTILVELTVLCMILSSLLGDFNERELAYRAWLPFDYSLPTYYYI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P82986-F1 | 126-369 | 47.20 | 89.26 | View in AlphaFoldDB ↗ |