DPCfam | MC100108
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Residues in low-complexity regions (%) | 1.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00858 |
| Sequences matching dominant architecture (%) | 87.1 |
| Average overlap percent | 28.13 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K8T2N4 | 61-153 | 92 | PKLLFSLNRTTGPGKVVFSTKEKLNLYLHSIDDVPTINHPKLEKIIVSKNRRGSEVQWVFKIQEIYNDPLLKTLPLQQRDCRFPE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q86LG9-F1 | 200-286 | 98.86 | 94.64 | View in AlphaFoldDB ↗ |