DPCfam | MC1
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 17931 |
|---|---|
| Mean domain length (aa) | 186 ± 29 aa |
| Residues in low-complexity regions (%) | 4.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.44 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF13614 |
| Sequences matching dominant architecture (%) | 44.23 |
| Average overlap percent | 80.82 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A174XKL9 | 3-229 | 227 | KIVAITNFKGGVGKTATTLNLGAALFVAGKKVLLIDNDPQGNLTAALGYTPAEQKRTLANLLLAAIDYPEDLEMHIGRAVLQTGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0A149-F1 | 4-181 | 94.12 | 96.24 | View in AlphaFoldDB ↗ |